PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_001380-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family WRKY
Protein Properties Length: 321aa    MW: 35445.5 Da    PI: 8.8196
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_001380-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY106.71.1e-33184241259
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    +Dgy+WrKYGqK vk+s++prsYYrCts++C+vkk+vers +dp++v++tYeg+H+h+
  NNU_001380-RA 184 EDGYRWRKYGQKAVKNSPYPRSYYRCTSQKCSVKKRVERSFQDPSIVITTYEGQHTHQ 241
                    8********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.2E-35168243IPR003657WRKY domain
SuperFamilySSF1182901.44E-29175243IPR003657WRKY domain
PROSITE profilePS5081131.674178243IPR003657WRKY domain
SMARTSM007747.4E-40183242IPR003657WRKY domain
PfamPF031061.8E-26184241IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MSGEARNLFH HDLPFHDDRR NVGKSGFIPF STDPPSMFNQ SVHGLGDSAA RDLNGFDPSY  60
LSFTDCLHGA LDYSTLSRAF DLSCSPPDAF HPVDDATQKT GGMGESTGTT DIPATPNSSV  120
SSSSTEAAGE EDSGKSKKDR QPKGSEDAVD KPNKKVSKPK KKGEKRQREP RFAFMTKSEV  180
DHLEDGYRWR KYGQKAVKNS PYPRSYYRCT SQKCSVKKRV ERSFQDPSIV ITTYEGQHTH  240
QSPSTLRGNA AAMMAPSMLT PPPPAGPIFP QELLLQLPST NNQAAATRSS LYQQTLAQQL  300
RLPDYGLLQD MVPSFIHRQL S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-27173244778Probable WRKY transcription factor 4
2lex_A1e-27173244778Probable WRKY transcription factor 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010275648.10.0PREDICTED: probable WRKY transcription factor 71
SwissprotQ8VWJ21e-63WRK28_ARATH; Probable WRKY transcription factor 28
TrEMBLD7TK051e-116D7TK05_VITVI; WRKY8
STRINGVIT_10s0003g02810.t011e-116(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18170.12e-59WRKY DNA-binding protein 28